Primary Antibodies

View as table Download

Rabbit Polyclonal TCIRG1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TCIRG1 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human TCIRG1.

ABO Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABO

DBH Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DBH

Rabbit anti-HSD17B2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSD17B2

Rabbit anti-AOC3 Polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AOC3

Rabbit Polyclonal Anti-Tyrp1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Tyrp1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: AHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLEN

Rabbit Polyclonal Anti-B3galnt1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-B3galnt1 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FTGYPLIENYSYRGFFHKNHISYQEYPFKVFPPYCSGLGYIMSGDLVPKI

Rabbit Polyclonal Anti-Alg8 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Alg8 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LELKLLDPSQIPRASMTSGLVQQSQHTVLPSVSPSATLICTLIAILPSVF

Rabbit Polyclonal Anti-Atp6v0b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Atp6v0b Antibody is: synthetic peptide directed towards the N-terminal region of Rat Atp6v0b. Synthetic peptide located within the following region: PSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVG

Rabbit Polyclonal Anti-Smpd4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Smpd4 antibody is: synthetic peptide directed towards the middle region of Rat Smpd4. Synthetic peptide located within the following region: LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP

Rabbit Polyclonal Anti-TUSC3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TUSC3 Antibody: A synthesized peptide derived from human TUSC3

Rabbit Polyclonal Anti-COX42 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX42 Antibody: A synthesized peptide derived from human COX42

Rabbit Polyclonal Anti-COX6C Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C

Rabbit Polyclonal Anti-COX IV antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX IV antibody: A synthesized peptide derived from human COX IV

DEGS1 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the Human DEGS1 protein.