Primary Antibodies

Jump to Filters
View as table Download
SCN11A Rabbit Polyclonal Antibody
TA322395

USD 380.00

2 Weeks

Anti-SCN11A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 29-41 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA890121

USD 407.00

In Stock

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A
SCN2A Rabbit Polyclonal Antibody
TA322242

USD 380.00

2 Weeks

Anti-SCN2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 30-43 amino acids of human sodium channel, voltage-gated, type II, alpha subunit
SCN11A Rabbit Polyclonal Antibody
TA322393

USD 380.00

4 Weeks

Anti-SCN1A/2A/3A/4A/5A/8A/9A/10A/11A/12A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1503-1520 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit
Nav1.5 (SCN5A) Rabbit Polyclonal Antibody
TA338380

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-SCN5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the N terminal of human SCN5A. Synthetic peptide located within the following region: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH