Primary Antibodies

Jump to Filters
View as table Download
CD40L (CD40LG) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: MK13A4]
TA700027

USD 494.00

In Stock

CD40L biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA
Reactivities Human
Conjugation Biotin
Matched ELISA Pair TA600027
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1C1]
TA506513S

USD 200.00

In Stock

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

NMDAR2B (GRIN2B) Rabbit Polyclonal Antibody
TA309191

USD 545.00

2 Weeks

Rabbit Anti-NMDA NR2B Subunit Antibody

Applications WB
Reactivities Rat, Mouse, Human
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2B subunit
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA890121

USD 407.00

In Stock

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A
TRIM21 Rabbit Polyclonal Antibody
TA308743

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to SSA1 (tripartite motif-containing 21)

Applications IF, IHC, WB
Reactivities Human (Predicted: Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 254 and 475 of SSA1 (Uniprot ID#P19474)
Complement C9 (C9) Goat Polyclonal Antibody
TA326742

USD 520.00

5 Days

Goat Anti-C9 (aa205-216) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ETKGEKNFRTEH, from the internal region of the protein sequence according to NP_001728.1.
TRIM21 Rabbit Polyclonal Antibody
TA335782

USD 485.00

5 Days

Rabbit Polyclonal Anti-TRIM21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the N terminal of human TRIM21. Synthetic peptide located within the following region: CPVCRQRFLLKNLRPNRQLANMVNNLKEISQEAREGTQGERCAVHGERLH
Complement C5 (C5) Mouse Monoclonal Antibody [Clone ID: HCC5.1]
BM5030

USD 410.00

2 Weeks

Complement C5 (C5) mouse monoclonal antibody, clone HCC5.1, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
C2 Rabbit Polyclonal Antibody
TA346155

USD 539.00

5 Days

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: B-F7]
TA352746

USD 640.00

3 Weeks

Mouse Monoclonal Anti-TNF-alpha Antibody

Reactivities Human
Conjugation Unconjugated