Primary Antibodies

Jump to Filters
View as table Download
MEIS2 Rabbit Polyclonal Antibody
TA337288

USD 539.00

5 Days

Rabbit Polyclonal Anti-MEIS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MEIS2 antibody: synthetic peptide directed towards the middle region of human MEIS2. Synthetic peptide located within the following region: KGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHS
MEIS2 Goat Polyclonal Antibody
TA311585

USD 520.00

5 Days

Goat Anti-MEIS2 Antibody

Applications WB
Reactivities Mouse, Rat (Expected from sequence similarity: Human, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-QSNRAGFLLDPSVSQ, from the internal region of the protein sequence according to NP_733777.1; NP_733775.1; NP_758526.1.