Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SPRY1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPRY1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPRY1. Synthetic peptide located within the following region: PTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPRQEKHERTHEIIPIN

Goat Anti-Sprouty Antibody

Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CPSRGQGKPS, from the C Terminus of the protein sequence according to NP_005832.1; NP_955359.1.