Primary Antibodies

Jump to Filters
View as table Download
ABCB4 Rabbit Polyclonal Antibody
AP13075PU-N

USD 580.00

2 Weeks

ABCB4 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 624-654 amino acids from the Central region of Human ABCB4.
ABCB4 Rabbit Polyclonal Antibody
TA346193

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ABCB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM
ABCB4 Rabbit Polyclonal Antibody
TA367528

USD 380.00

4 Weeks

ABCB4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCB4