Primary Antibodies

Jump to Filters
View as table Download
Cryptochrome I (CRY1) Rabbit Polyclonal Antibody
TA342728

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-CRY1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
NR1D1 Rabbit Polyclonal Antibody
TA350237

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-NR1D1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR1D1
PER2 Rabbit Polyclonal Antibody
TA345366

USD 539.00

5 Days

Rabbit Polyclonal Anti-PER2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PER2 antibody: synthetic peptide directed towards the middle region of human PER2. Synthetic peptide located within the following region: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ
BMAL1 (ARNTL) Rabbit Polyclonal Antibody
TA301766

USD 550.00

5 Days

Rabbit Polyclonal Antibody against BMAL

Applications ChIP, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bacterially expressed human BMAL1