BMP6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6. |
BMP6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6. |
Rabbit Polyclonal Anti-WNT5A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
PTCH1 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1) |
Anti-SMO Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 772-787 amino acids of human smoothened, frizzled family receptor |
Rabbit polyclonal anti-CKI-a antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CKI-a. |
Rabbit Polyclonal Anti-SHH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Chicken |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |