Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-DGAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DGAT1

DGAT1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DGAT1

DGAT1 Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

DGAT1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human DGAT1 (NP_036211.2).
Modifications Unmodified

Goat Polyclonal Antibody against DGAT1

Applications WB
Reactivities Human, Rat (Expected from sequence similarity: Mouse, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-QNSMKPFKDMDYS, from the internal region of the protein sequence according to NP_036211.1.

Rabbit Polyclonal Anti-DGAT1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dgat1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dgat1. Synthetic peptide located within the following region: HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI