Germany
Japan
United Kingdom
China
Goat Anti-GLP-1-R (mouse) Antibody
| Applications | E, IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SKRGERNFPEEQ, from the internal region of the protein sequence according to NP_067307.2. |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-Glp1r Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Glp1r antibody is: synthetic peptide directed towards the middle region of Mouse Glp1r. Synthetic peptide located within the following region: YRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLYIIYTV |
Rabbit polyclonal anti-GLP1R antibody
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLP1R. |
