Primary Antibodies

Jump to Filters
View as table Download
VPS28 Rabbit Polyclonal Antibody
TA350605

USD 380.00

In Stock

Rabbit Polyclonal Anti-VPS28 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
VPS28 Goat Polyclonal Antibody
TA302924

USD 520.00

In Stock

Goat Polyclonal Antibody against VPS28

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence C-ESAYNAFNRFLHA, from the C Terminus of the protein sequence according to NP_057292.1.
VPS28 Rabbit Polyclonal Antibody
TA345056

USD 539.00

5 Days

Rabbit Polyclonal Anti-VPS28 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS28 antibody: synthetic peptide directed towards the N terminal of human VPS28. Synthetic peptide located within the following region: MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ