Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Chicken, Rat, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 68 and 327 of ST3GAL2 (Uniprot ID#Q16842)

Rabbit Polyclonal Anti-ST3GAL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST3GAL2 antibody: synthetic peptide directed towards the C terminal of human ST3GAL2. Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN