ST3GAL2 Rabbit Polyclonal Antibody

CAT#: TA341870

Rabbit Polyclonal Anti-ST3GAL2 Antibody

Product Images

WB Suggested Anti-ST3GAL2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ST3GAL2 antibody: synthetic peptide directed towards the C terminal of human ST3GAL2. Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 2
• Database Link:
  NP_008858
  Entrez Gene 6483 Human
  UniProt ID Q16842
• Background: The protein encoded byThis gene is a type II membrane protein that catalyzesThe transfer of sialic acid from CMP-sialic acid to galactose-containing substrates.The encoded protein is normally found inThe Golgi but can be proteolytically processed to a soluble form.This protein, which is a member of glycosyltransferase family 29, can useThe same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq, Jul 2008]
• Synonyms: Gal-NAc6S; SIAT4B; ST3GalA.2; ST3GALII
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - ganglio series, Glycosphingolipid biosynthesis - globo series, Keratan sulfate biosynthesis, Metabolic pathways, O-Glycan biosynthesis