Primary Antibodies

View as table Download

PTEN mouse monoclonal antibody, clone OTI5A5 (formerly 5A5)

Applications IHC
Reactivities Mouse, Rat
Conjugation Unconjugated

PTEN mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Reactivities Human
Conjugation Unconjugated

PTEN mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTEN mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTEN mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Reactivities Human
Conjugation Unconjugated

Mouse anti pTEN Monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PTEN rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 381-396 amino acids of human phosphatase and tensin homolog

Rabbit Polyclonal Anti-INPP5K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF

Rabbit polyclonal PTEN (Ab-370) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370.