IFNGR1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IFNGR1 |
IFNGR1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IFNGR1 |
IFNGR1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IFNGR1 |
IFNGR1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 430-480 of Human IFN-γRα |
Rabbit anti-IFNGR1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IFNGR1 |
Recombinant Anti-IFN-gamma receptor 1 (Clone GR20)
Applications | Bl, FC, Neutralize |
Reactivities | Mouse |
Conjugation | Unconjugated |
IFNGR1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 460-489 amino acids from the C-terminal region of human IFNGR1 |
Rabbit Polyclonal Anti-IFNGR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IFNGR1 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNGR1. Synthetic peptide located within the following region: EVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVS |
IFNGR1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human IFNGR1 |
Recombinant Anti-IFN-gamma receptor 1 (Clone GR20)
Applications | Bl, FC, Neutralize |
Reactivities | Mouse |
Conjugation | Unconjugated |
CD119 Rabbit pAb
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
CD119 polyclonal antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD119. |