CACNB1 mouse monoclonal antibody,clone OTI3H6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
CACNB1 mouse monoclonal antibody,clone OTI3H6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CACNB1 mouse monoclonal antibody,clone OTI3H6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CACNB2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CACNB2 |
Rabbit polyclonal CACNG6 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse) |
Conjugation | Unconjugated |
Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit polyclonal CACNA2D2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Rabbit Polyclonal Anti-CACNB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CACNB1 |
Rabbit polyclonal CACNA2D3 Antibody (C-term)
Applications | FC, WB |
Reactivities | Human (Predicted: Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | This CACNA2D3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1026-1053 amino acids from the C-terminal region of human CACNA2D3. |
CACNB1 mouse monoclonal antibody,clone OTI3H6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Mouse Monoclonal anti-CACNB2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-CACNA2D4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNA2D4. |
Goat Polyclonal Antibody against CACNB4 (internal)
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DYPDSYQDTYKPH, from the internal region (near the C Terminus) of the protein sequence according to NP_001005747.1; NP_000717.2; NP_001005746.1. |
Goat Anti-CACNB2 (aa565-579) Antibody
Applications | WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence ECNKQRSRHKSKDRY, from the C Terminus of the protein sequence according to NP_000715.2; NP_963890.2; NP_963884.2; NP_963891.1; NP_963887.2; NP_963865.2; NP_963864.1; NP_963866.2; NP_001161417.1. |
Rabbit polyclonal anti-CACNG1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG1. |
Rabbit polyclonal anti-CACNG7 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG7. |
Rabbit Polyclonal Anti-Cacng3 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cacng3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARS |