Rabbit Polyclonal Anti-PAX7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK |
Rabbit Polyclonal anti-Pax7 antibody
| Applications | IF, WB |
| Reactivities | Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pax7 antibody: synthetic peptide directed towards the middle region of human Pax7. Synthetic peptide located within the following region: SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ |
Rabbit Polyclonal Anti-PAX7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the middle region of human PAX7. Synthetic peptide located within the following region: KPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPI |
Pax7 Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Pax7 affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Pax7 protein. |
Pax7 Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Pax7 affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Pax7 protein. |
PAX7 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 180-210 amino acids from the Central region of human PAX |
Rabbit Polyclonal Anti-PAX7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: CDRSTVPSGLVSSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGIL |
Rabbit Polyclonal Anti-PAX7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PAX7 antibody is: synthetic peptide directed towards the C-terminal region of PAX7. Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT |
PAX7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 289-518 of human PAX7 (NP_039236.1). |
| Modifications | Unmodified |
Paired box protein Pax-7 (PAX7B) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from C-terminal domain of PAX7B protein |
Germany
Japan
United Kingdom
China
