Primary Antibodies

Jump to Filters
View as table Download
MAFA (Center) Rabbit Polyclonal Antibody
AP52582PU-N

USD 580.00

2 Weeks

MAFA (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 209~238 amino acids from the Central region of Human MAFA.
MAFA Rabbit Polyclonal Antibody
TA342515

USD 539.00

5 Days

Rabbit Polyclonal Anti-MAFA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MAFA antibody: synthetic peptide directed towards the N terminal of human MAFA. Synthetic peptide located within the following region: KPALEDLYWMSGYQHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAA