Primary Antibodies

View as table Download

Plasminogen (PLG) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Plasminogen isolated and purified from human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Leptin (LEP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 7-37 amino acids from the N-terminal region of Human Leptin.

Anti-LHB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 114-128 amino acids of Human luteinizing hormone beta polypeptide

Rabbit Polyclonal Anti-CGA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CGA

Rabbit Polyclonal Anti-GH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GH2

Rabbit Polyclonal Anti-PLG Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLG

Goat Polyclonal Antibody against Leptin Receptor

Applications FC, IHC, PEP-ELISA, WB
Reactivities Human (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-TQDDIEKHQSDAG, from the internal region of the protein sequence according to NP_002294.2; NP_001003679.1; NP_001003680.1.

Anti-Human Leptin Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Leptin

Rabbit Polyclonal Anti-GH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GH1

Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum

Applications ELISA, IHC, R, WB
Reactivities Bovine, Deer, Goat, Human, Sheep
Conjugation Unconjugated
Immunogen Bovine Luteinizing Hormone

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2

Rabbit polyclonal GABA B Receptor antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GABA B receptor.

Biotinylated Anti-Human Leptin Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Biotin
Immunogen E.coli derived Recombinant Human Leptin

Trypsin (PRSS3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 143-171 amino acids from the Central region of Human Trypsin-3 / PRSS3