Primary Antibodies

View as table Download

PSME2 (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human PSME2

Goat Polyclonal Antibody against PSME2

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-NLEKIVNPKGEEKP, from the C Terminus of the protein sequence according to NP_002809.2.

PSME2 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human PSME2

Rabbit anti-PSME2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PSME2

Rabbit polyclonal Anti-PSME2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: QEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVH

Rabbit polyclonal Anti-PSME2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV