Primary Antibodies

Jump to Filters
View as table Download
Z DNA binding protein (ZBP1) Rabbit Polyclonal Antibody
TA306502

USD 570.00

2 Weeks

Rabbit Polyclonal ZBP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZBP1 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human ZBP1.
Z DNA binding protein (ZBP1) Rabbit Polyclonal Antibody
TA341712

USD 485.00

5 Days

Rabbit Polyclonal Anti-ZBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBP1 antibody: synthetic peptide directed towards the middle region of human ZBP1. Synthetic peptide located within the following region: LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG