Primary Antibodies

Jump to Filters
View as table Download
GPR91 (SUCNR1) Rabbit Polyclonal Antibody
AP01338PU-N

USD 465.00

3 Weeks

GPR91 (SUCNR1) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 102-154 of Human GPR91.
GPR91 (SUCNR1) Rabbit Polyclonal Antibody
TA315622

USD 380.00

4 Weeks

Rabbit polyclonal anti-SUCNR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SUCNR1.
GPR91 (SUCNR1) Rabbit Polyclonal Antibody
TA347971

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-SUCNR1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SUCNR1 Antibody: A synthesized peptide derived from human SUCNR1
GPR91 (SUCNR1) Rabbit Polyclonal Antibody
TA334388

USD 539.00

5 Days

Rabbit Polyclonal Anti-SUCNR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUCNR1 antibody is: synthetic peptide directed towards the middle region of Human SUCNR1. Synthetic peptide located within the following region: INPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKI
GPR91 (SUCNR1) Rabbit Polyclonal Antibody
TA340857

USD 515.00

5 Days

Rabbit Polyclonal Anti-SUCNR1 Antibody (C-Terminus)

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen SUCNR1 / GPR91 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human GPR91. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Gorilla, Gibbon, Marmoset (94%).