Primary Antibodies

Jump to Filters
View as table Download
GRPR Rabbit Polyclonal Antibody
TA316872

USD 515.00

2 Weeks

GRPR Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Dog, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%).
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody
TA328665

USD 850.00

2 Weeks

Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus.
beta 2 Adrenergic Receptor (ADRB2) Rabbit Polyclonal Antibody
TA323758

USD 380.00

2 Weeks

Anti-ADRB2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 2, surface
BDKRB1 Rabbit Polyclonal Antibody
TA317579

USD 515.00

In Stock

B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%).
alpha 1a Adrenergic Receptor (ADRA1A) Rabbit Polyclonal Antibody
TA308493

USD 625.00

5 Days

Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)

Applications IF, IHC, WB
Reactivities Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348)
5HT7 Receptor (HTR7) (8-23) Rabbit Polyclonal Antibody
24430

USD 660.00

2 Weeks

5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA321416

USD 380.00

4 Weeks

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor
HTR2C Rabbit Polyclonal Antibody
TA330447

USD 485.00

5 Days

Rabbit Polyclonal Anti-HTR2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR2C antibody: synthetic peptide directed towards the N terminal of human HTR2C. Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA
CysLT1 (CYSLTR1) Rabbit Polyclonal Antibody
TA340418

USD 515.00

In Stock

Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)

Applications IHC
Reactivities Human (Predicted: Monkey, Mouse)
Conjugation Unconjugated
Immunogen CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%).
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody
TA306839

USD 570.00

2 Weeks

Rabbit Polyclonal AGTR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1.
GRPR Rabbit Polyclonal Antibody
TA321704

USD 380.00

In Stock

Anti-GRPR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 350-365 amino acids of Human gastrin-releasing peptide receptor
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA328618

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-Human Protease-activated Receptor-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)KNESGLTEYRLVSINK, corresponding to amino acid residues 61-76 of human PAR-1. Extracellular, N terminal.
PTGER3 Rabbit Polyclonal Antibody
TA341049

USD 515.00

5 Days

Rabbit Polyclonal Anti-PTGER3 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen PTGER3 / EP3 antibody was raised against synthetic 17 amino acid peptide from 1st cytoplasmic domain of human PTGER3 / EP3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda, Bat (100%); Mouse (94%); Xenopus (88%); Bovine, Pig, Opossum (82%).
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA341637

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
CCKBR Goat Polyclonal Antibody
TA303029

USD 520.00

5 Days

Goat Polyclonal Antibody against CCKBR

Applications IHC, WB
Reactivities Human, Rat (Expected from sequence similarity: Mouse, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-FDGDSDSDSQSRVRNQ, from the internal region of the protein sequence according to NP_795344.1.