Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CXXC5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CXXC5

Rabbit Polyclonal CXXC5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CXXC5 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human CXXC5.

Rabbit Polyclonal Anti-CXXC5 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cxxc5 antibody is synthetic peptide directed towards the N-terminal region of Mouse Cxxc5. Synthetic peptide located within the following region: MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAPTSVAD