Rabbit Polyclonal Anti-PGK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PGK2 |
Rabbit Polyclonal Anti-PGK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PGK2 |
Rabbit Polyclonal Anti-PGK2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PGK2 Antibody: synthetic peptide directed towards the C terminal of human PGK2. Synthetic peptide located within the following region: ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM |