Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-AGAP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human AGAP2

Centaurin gamma 1 (AGAP2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 850-877 amino acids from the C-terminal region of human CENTG1

Goat Anti-CENTG1 / PIKE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QASLDSIREAVINSQ, from the internal region of the protein sequence according to NP_055585.1.

Rabbit polyclonal anti-AGAP2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to amino acids 1-836 of human AGAP2 protein.

Rabbit Polyclonal Anti-CENTG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CENTG1 antibody: synthetic peptide directed towards the middle region of human CENTG1. Synthetic peptide located within the following region: AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG