Goat Anti-TAF7L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NHFQSVLEQLELQEK, from the internal region (near C Terminus) of the protein sequence according to NP_079161.2. |
Goat Anti-TAF7L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NHFQSVLEQLELQEK, from the internal region (near C Terminus) of the protein sequence according to NP_079161.2. |
Rabbit Polyclonal Anti-TAF7L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAF7L Antibody: synthetic peptide directed towards the middle region of human TAF7L. Synthetic peptide located within the following region: QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ |
TAF7L Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |