Germany
Japan
United Kingdom
China
Anti-ACO1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-MDH2 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDH2 antibody: synthetic peptide directed towards the C terminal of human MDH2. Synthetic peptide located within the following region: TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK |
Goat Polyclonal Anti-MDH1 / MOR2 (aa211-223) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MDH1 / MOR2 (aa211-223) Antibody: Peptide with sequence C-PDVNHAKVKLQGK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1. |
Goat Polyclonal Anti-MDH1 / MOR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MDH1 / MOR2 Antibody: Peptide with sequence TNCLTASKSAPSIPK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1. |
MDH1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Malic dehydrogenase is isolated and purified from Human erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Malic dehydrogenase is isolated and purified from Human erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Malic dehydrogenase is isolated and purified from Human erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Malic dehydrogenase is isolated and purified from Human placenta. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Malic dehydrogenase is isolated and purified from Human placenta. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Malic dehydrogenase is isolated and purified from Human placenta. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-MTHFD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYV |
Rabbit Polyclonal Anti-MDH1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MDH1 |
Rabbit Polyclonal Anti-PGP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGP antibody is: synthetic peptide directed towards the C-terminal region of PGP. Synthetic peptide located within the following region: TDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIA |
Rabbit Polyclonal Anti-HAO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAO2 antibody: synthetic peptide directed towards the N terminal of human HAO2. Synthetic peptide located within the following region: DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW |
Rabbit Polyclonal Anti-MTHFD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE |
Active filters
Applications
- WB
Isotypes
- IgG
Pathways
- Glyoxylate and dicarboxylate metabolism