Primary Antibodies

View as table Download

Rabbit Polyclonal EPM2A Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EPM2A antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human EPM2A.

Goat Anti-Laforin (isoform a) Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EATGHTNEMKHTTD, from the internal region of the protein sequence according to NP_005661.1.

Rabbit Polyclonal Anti-EPM2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPM2A antibody is: synthetic peptide directed towards the N-terminal region of Human EPM2A. Synthetic peptide located within the following region: PGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDGVYCLPIG

EPM2A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated