Primary Antibodies

View as table Download

TANK mouse monoclonal antibody,clone OTI1G2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TANK mouse monoclonal antibody,clone OTI1G2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

TANK mouse monoclonal antibody,clone OTI1G2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal TANK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TANK antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TANK.

Rabbit Polyclonal TANK Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TANK antibody was raised against a 14 amino acid peptide from near the amino terminus of human TANK.

Rabbit Polyclonal anti-TANK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TANK antibody is: synthetic peptide directed towards the N-terminal region of Human TANK. Synthetic peptide located within the following region: ILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQ

Rabbit Polyclonal Anti-TANK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TANK antibody: synthetic peptide directed towards the C terminal of human TANK. Synthetic peptide located within the following region: KPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH

Rabbit Polyclonal Anti-TANK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TANK antibody: synthetic peptide directed towards the N terminal of human TANK. Synthetic peptide located within the following region: DKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQ