Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 47 and 251 of alpha Glucosidase II

Rabbit Polyclonal Anti-ALG6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALG6 antibody: synthetic peptide directed towards the N terminal of human ALG6. Synthetic peptide located within the following region: YEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVA

MAN2A2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 766-796 amino acids from the Central region of human MAN2A2

Rabbit polyclonal anti-B4GALT1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human B4GALT1.

Mannosidase II (MAN2A1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 456-482 amino acids from the Central region of human Alpha-Mannosidase 2 / MAN2A1

Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Monkey, Pig, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697)

Rabbit polyclonal anti-TUSC3 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TUSC3.

Goat Polyclonal Antibody against TUSC3

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence PQRQCSVCRQAN, from the internal region of the protein sequence according to NP_006756.2; NP_839952.1.

Rabbit Polyclonal Anti-ALG6 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ALG6

Goat Polyclonal Antibody against MAN2A1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KISSDIKSQNR, from the internal region of the protein sequence according to NP_002363.2.

Goat Anti-MGAT1 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-QVEKVRTNDR, from the internal region of the protein sequence according to NP_002397.2.

Rabbit Polyclonal Anti-GANAB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GANAB Antibody: synthetic peptide directed towards the middle region of human GANAB. Synthetic peptide located within the following region: IIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHL

Rabbit Polyclonal Anti-DOLPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DOLPP1 antibody: synthetic peptide directed towards the N terminal of human DOLPP1. Synthetic peptide located within the following region: AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI

Rabbit Polyclonal Anti-GCS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GCS1 antibody: synthetic peptide directed towards the N terminal of human GCS1. Synthetic peptide located within the following region: GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ

Rabbit Polyclonal Anti-ALG6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALG6 antibody: synthetic peptide directed towards the N terminal of human ALG6. Synthetic peptide located within the following region: PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLI