Anti-CDK6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6 |
Anti-CDK6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6 |
CDK6 mouse monoclonal antibody, clone 8H4, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
CDK6 Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-326 of human CDK6 (NP_001250.1). |
Modifications | Unmodified |
CDK6 pTyr24 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic phosphopeptide derived from human CDK6 around the phosphorylation site of Tyrosine 24 (G-A-YP-G-K). |
CDK6 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human CDK6 |
CDK6 pTyr24 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic phosphopeptide derived from human CDK6 around the phosphorylation site of Tyrosine 24 (G-A-YP-G-K). |
CDK6 pTyr13 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from Human CDK6 around the phosphorylation site of Tyrosine 13 (Q-Q-Yp-E-C). |
CDK6 pTyr13 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from Human CDK6 around the phosphorylation site of Tyrosine 13 (Q-Q-Yp-E-C). |
Anti-CDK6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of human Cyclin-dependent kinase 6 |
CDK6 Rabbit monoclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Phospho-CDK6-Y13 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDK6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDK6 antibody: synthetic peptide directed towards the C terminal of human CDK6. Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA |
CDK6 mouse monoclonal antibody, clone DCS-83.1, Purified
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CDK6 mouse monoclonal antibody, clone IML-6, Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |