Primary Antibodies

View as table Download

POLR3C (RPC62) mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) POLR3C mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POLR3C (RPC62) mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit polyclonal RPC3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC3.

Rabbit Polyclonal Anti-POLR3C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3C antibody: synthetic peptide directed towards the middle region of human POLR3C. Synthetic peptide located within the following region: VEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQV

POLR3C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human POLR3C