Primary Antibodies

View as table Download

Rabbit polyclonal CDK4 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4.

CDK4 Antibody - C-terminal region

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

CDK4 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human CDK4.

CDK4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CDK4

Phospho-CDK4-T172 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around T172 of human CDK4 (NP_000066.1).
Modifications Phospho T172

Rabbit polyclonal anti-R Cdk4 antibody (C-term)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen This Rat Cdk4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 272-303 amino acids from the C-terminal region of rat Cdk4.

Rabbit Polyclonal Anti-CDK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK4 antibody: synthetic peptide directed towards the C terminal of human CDK4. Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

CDK4 Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of rat CDK4

CDK4 rabbit polyclonal antibody, Serum

Applications ELISA, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen cdk4 (p34) peptide corresponding to the C-terminus of the human protein conjugated to Keyhole
Limpet Hemocyanin (KLH).

CDK4 rabbit polyclonal antibody, Purified

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TrpE-fusion protein containing the C-terminal 164 amino acids of human Cdk4.