Primary Antibodies

Jump to Filters
View as table Download
UBE2Q2 (Center) Rabbit Polyclonal Antibody
AP54442PU-N

USD 580.00

2 Weeks

UBE2Q2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 167-196 amino acids from the Central region of human UBE2Q2
UBE2Q2 Rabbit Polyclonal Antibody
TA337794

USD 539.00

5 Days

Rabbit Polyclonal Anti-UBE2Q2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2Q2 antibody is: synthetic peptide directed towards the middle region of Human UBE2Q2. Synthetic peptide located within the following region: EDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGA