Primary Antibodies

View as table Download

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human (Predicted: Mouse, Rat, Drosophila)
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Anti-MAP2K1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 15-28 amino acids of human mitogen-activated protein kinase kinase 1

Anti-MAP2K2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 20-34 amino acids of Human mitogen-activated protein kinase kinase 2

Rabbit Polyclonal Anti-PRKX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKX

Rabbit polyclonal MEK2 (MAP2K2) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This MEK2 (MAP2K2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-292 amino acids from the Central region of human MEK2 (MAP2K2).

Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612)

Rabbit polyclonal MAPK3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3.

Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C).
Modifications Phospho-specific

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit polyclonal PKA CAT (Ab-197) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C).

Rabbit polyclonal Anti-FYN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FYN antibody: synthetic peptide directed towards the N terminal of human FYN. Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

Rabbit polyclonal MAPK1 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Xenopus)
Conjugation Unconjugated
Immunogen This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1.

Rabbit polyclonal FYN Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human (Predicted: Bovine, Pig)
Conjugation Unconjugated
Immunogen This FYN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human FYN.

Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204
Modifications Phospho-specific

Rabbit polyclonal anti-PRKX antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKX.