Rabbit Polyclonal Anti-PSTPIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSTPIP1 antibody is: synthetic peptide directed towards the N-terminal region of Human PSTPIP1. Synthetic peptide located within the following region: LLRQRAQAEERYGKELVQIARKAGGQTEINSLRASFDSLKQQMENVGSSH |
PSTPIP1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 88-118 amino acids from the N-terminal region of Human PSTPIP1 / CD28P1 |
PSTPIP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PSTPIP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PSTPIP1 |
PSTPIP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PSTPIP1 |
Germany
Japan
United Kingdom
China