Rabbit Polyclonal Anti-PROC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PROC antibody: synthetic peptide directed towards the middle region of human PROC. Synthetic peptide located within the following region: PCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLD |
Rabbit polyclonal antibody to Protein C (protein C (inactivator of coagulation factors Va and VIIIa))
| Applications | WB |
| Reactivities | Human (Predicted: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 145 and 461 of Protein C (Uniprot ID#P04070) |
Rabbit polyclonal PROC (light chain, Cleaved-Leu179) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PROC. |
Rabbit Polyclonal Anti-PROC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PROC antibody: synthetic peptide directed towards the N terminal of human PROC. Synthetic peptide located within the following region: MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL |
Germany
Japan
United Kingdom
China
