Rabbit Polyclonal Anti-WHSC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-WHSC1 Antibody: synthetic peptide directed towards the N terminal of human WHSC1. Synthetic peptide located within the following region: KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFG |
Rabbit Polyclonal Anti-Wipf1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Wipf1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Wipf1. Synthetic peptide located within the following region: MPVPPPPAPPPPPTFALANTEKPSLNKTEQAGRNALLSDISKGKKLKKTV |
Germany
Japan
United Kingdom
China