Primary Antibodies

Jump to Filters
View as table Download
GCNT3 Rabbit Polyclonal Antibody
TA332087

USD 485.00

5 Days

Rabbit Polyclonal Anti-GCNT3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
GALNT3 (Center) Rabbit Polyclonal Antibody
AP51768PU-N

USD 580.00

2 Weeks

GALNT3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 461~490 amino acids from the Center region of human GALNT3