Germany
Japan
United Kingdom
China
PDE7A rabbit polyclonal antibody, Serum
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Designed from the C-terminal region common to the 7A isoform. |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-PDE7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE7A antibody is: synthetic peptide directed towards the C-terminal region of Human PDE7A. Synthetic peptide located within the following region: DRGDLCLEDTRHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQ |
PDE7A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PDE7A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 345-456 of human PDE7A (NP_002594.1). |
| Modifications | Unmodified |
