Primary Antibodies

View as table Download

Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23.
Modifications Phospho-specific

Rabbit Polyclonal Anti-NFKBIB Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the N terminal of human NFKBIB. Synthetic peptide located within the following region: LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTAL

Rabbit Polyclonal IkappaB-beta Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IkappaB-beta

Rabbit Polyclonal I kappaB- beta (Ser23) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human I kappaB- beta around the phosphorylation site of Serine 23
Modifications Phospho-specific

Rabbit anti-NFKBIB Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NFKBIB

Rabbit Polyclonal Anti-NFKBIB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the middle region of human NFKBIB. Synthetic peptide located within the following region: PILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRS

Rabbit Polyclonal Anti-NFKBIB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the N terminal of human NFKBIB. Synthetic peptide located within the following region: DLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVCA