Primary Antibodies

View as table Download

Rabbit Polyclonal NFATC1/NFAT2 Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Amino acids 264-282 (NKRKYSLNGRQPPYSPHHS) of human NFATc1 were used as immunogen for this antibody.

NFAT2 (NFATC1) mouse monoclonal antibody, clone AT1C3, Purified

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

NFAT2 (NFATC1) mouse monoclonal antibody, clone AT1C3, Purified

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal anti-NFATc1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NFATC1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NFATC1

Rabbit Polyclonal Anti-NFATC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the C terminal of human NFATC1. Synthetic peptide located within the following region: LLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS

Rabbit Polyclonal Anti-NFATC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the N terminal of human NFATC1. Synthetic peptide located within the following region: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASS

Rabbit Polyclonal Anti-NFATC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the N terminal of human NFATC1. Synthetic peptide located within the following region: PSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSN

Rabbit Polyclonal Anti-ZNF83 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF83 antibody: synthetic peptide directed towards the N terminal of human ZNF83. Synthetic peptide located within the following region: MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSS

Rabbit Polyclonal Anti-NFATC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the N terminal of human NFATC1. Synthetic peptide located within the following region: PSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSN

NFATC1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC1

NFATC1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC1