Primary Antibodies

View as table Download

PDE3B mouse monoclonal antibody,clone OTI3F5

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDE3B mouse monoclonal antibody,clone OTI3F5

Applications WB
Reactivities Human
Conjugation Unconjugated

PDE3B mouse monoclonal antibody,clone OTI3F5, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

PDE3B (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 400-427 amino acids from the Central region of Human PDE3B

Rabbit Polyclonal Anti-PDE3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE3B antibody: synthetic peptide directed towards the middle region of human PDE3B. Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN