Primary Antibodies

Jump to Filters
View as table Download
Protein S (PROS1) Rabbit Polyclonal Antibody
TA335142

USD 539.00

5 Days

Rabbit polyclonal Anti-PROS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PROS1 antibody: synthetic peptide directed towards the middle region of human PROS1. Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
Protein S (PROS1) Rabbit Polyclonal Antibody
TA335143

USD 539.00

5 Days

Rabbit polyclonal Anti-Pros1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Pros1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS