Primary Antibodies

Jump to Filters
View as table Download
PI 3 Kinase catalytic subunit gamma (PIK3CG) Mouse Monoclonal Antibody [Clone ID: OTI2B1]
TA505221

USD 447.00

In Stock

PIK3CG mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PIK3CD Mouse Monoclonal Antibody [Clone ID: OTI6A12]
CF801780

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) PIK3CD mouse monoclonal antibody, clone OTI6A12 (formerly 6A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
IPMK Rabbit Polyclonal Antibody
TA308405

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to IPMK (inositol polyphosphate multikinase)

Applications IF, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 26 and 295 of IPMK (Uniprot ID#Q8NFU5)
PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody [Clone ID: OTI15H1]
TA801690S

USD 200.00

In Stock

PIK3C2A mouse monoclonal antibody, clone OTI15H1 (formerly 15H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PI 3 Kinase catalytic subunit alpha (PIK3CA) Rabbit Polyclonal Antibody
TA302178

USD 580.00

2 Weeks

Rabbit Polyclonal Antibody against PIK3CA (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA.
PTEN Mouse Monoclonal Antibody [Clone ID: A8A8]
TA354759

USD 425.00

5 Days

Mouse anti pTEN Monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
IPMK Rabbit Polyclonal Antibody
TA337886

USD 539.00

5 Days

Rabbit Polyclonal Anti-IPMK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IPMK antibody is: synthetic peptide directed towards the middle region of Human IPMK. Synthetic peptide located within the following region: SDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKIL
PIP5K1 beta (PIP5K1B) Rabbit Polyclonal Antibody
TA331347

USD 539.00

5 Days

Rabbit Polyclonal Anti-PIP5K1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIP5K1B antibody is: synthetic peptide directed towards the C-terminal region of Human PIP5K1B. Synthetic peptide located within the following region: VFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ
PIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody
TA343090

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-PIP5K1A Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pip5k1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a. Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS
ALDH6A1 Rabbit Polyclonal Antibody
TA339014

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALDH6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW