Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal antibody to SART1 (squamous cell carcinoma antigen recognized by T cells)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 137 and 447 of SART1 (Uniprot ID#O43290) |
Rabbit Polyclonal Anti-HNRNPU Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the C terminal of human HNRNPU. Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF |
Rabbit polyclonal anti-SFRS7 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SFRS7. |
Goat Polyclonal Antibody against DDX5 / p68 RNA helicase
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PMIGYPMPTGYSQ, from the C Terminus of the protein sequence according to NP_004387.1. |
Rabbit polyclonal anti-THOC4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human THOC4. |
Active filters
Category
- Antibodies
Applications
- WB
Isotypes
- IgG
Clonalities
- Polyclonal
Pathways
- Spliceosome
Availabilities
- In Stock