Mouse Monoclonal Antibody against Heterogenous Nuclear ribonucleoproteins M3/4 (2A6)
Applications | ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Rabbit |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against Heterogenous Nuclear ribonucleoproteins M3/4 (2A6)
Applications | ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Rabbit |
Conjugation | Unconjugated |
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse (Predicted: Sheep, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Rabbit Polyclonal Anti-WBP11 Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WBP11 antibody: synthetic peptide directed towards the N terminal of human WBP11. Synthetic peptide located within the following region: GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK |
Mouse Monoclonal hnRNP M1-M4 Antibody (1D8)
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Rabbit |
Conjugation | Unconjugated |
Rabbit anti-PRPF3 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRPF3 |
Rabbit anti-U2AF2 Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human U2AF2 |
Rabbit anti-LSM4 Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LSM4 |