Primary Antibodies

View as table Download

Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)

Applications IF, IHC, IP, WB
Reactivities Human (Predicted: Mouse, Rat, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993)

Anti-MCM7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 300 amino acids of human minichromosome maintenance complex component 7

Rabbit Polyclonal Anti-MCM7 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MCM7

Rabbit Polyclonal Anti-MCM7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the middle region of human MCM7. Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV