MAFB mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MAFB mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MAFB mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAFB mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MAFB mouse monoclonal antibody,clone 1E9, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MAFB mouse monoclonal antibody,clone 1E9, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) MAFB mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MAFB mouse monoclonal antibody,clone 2A6, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MAFB mouse monoclonal antibody,clone 2A6, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MAFB mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAFB mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAFB mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAFB mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MAFB mouse monoclonal antibody,clone 1F1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MAFB mouse monoclonal antibody,clone 1F1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-MAFB Antibody
Applications | IHC, WB |
Reactivities | Rat, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAFB antibody: synthetic peptide directed towards the N terminal of human MAFB. Synthetic peptide located within the following region: RPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMAS |